PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0276369.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 324aa    MW: 36789.2 Da    PI: 5.6713
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0276369.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.9e-141865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  Lj0g3v0276369.1 18 KGLWSPEEDDKLMNYMLNSGQGCWSDVARNAGLQRCGKSCRLRWINYL 65
                     678*******************************************97 PP

2Myb_DNA-binding52.41.2e-1671114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
  Lj0g3v0276369.1  71 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 114
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-231168IPR009057Homeodomain-like
PROSITE profilePS5129414.4411365IPR017930Myb domain
SuperFamilySSF466891.13E-2716112IPR009057Homeodomain-like
SMARTSM007172.4E-91767IPR001005SANT/Myb domain
PfamPF002491.2E-121865IPR001005SANT/Myb domain
CDDcd001675.65E-82165No hitNo description
PROSITE profilePS5129425.91866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2669121IPR009057Homeodomain-like
SMARTSM007174.9E-1670118IPR001005SANT/Myb domain
PfamPF002492.0E-1571114IPR001005SANT/Myb domain
CDDcd001671.64E-1173113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MRKPEPKNNN SNMTKLRKGL WSPEEDDKLM NYMLNSGQGC WSDVARNAGL QRCGKSCRLR  60
WINYLRPDLK RGAFSPQEEE LIIHLHSLLG NRWSQIAARL PGRTDNEIKN FWNSTIKKRL  120
KNLPSPNASE SSCEPNKKDH NNNGGFSFNS TQQDVDFIMP MFMTSSPSPT TTQATVLNTI  180
IERLPMLEHG IMNMPASGAG GFFNAPPRFL QSEIDNDHNN IKGFYLENGV FEGVPPLESV  240
IRTTTTSDHD LKVENKGDTN YSCYFDDINN IVNNCYISNN NKRPHENRGG VQEDLCPEEL  300
TMGEWDLEDL MKDVASFPFL DFSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27161205108B-MYB
1h8a_C9e-271612025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1400960.0BT140096.1 Lotus japonicus clone JCVI-FLLj-12H15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132019.11e-142hypothetical protein PHAVU_011G059800g
TrEMBLI3SHZ90.0I3SHZ9_LOTJA; Uncharacterized protein
STRINGGLYMA11G14200.21e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-61myb domain protein 46